PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_53744.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 307aa    MW: 34064.7 Da    PI: 8.5569
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_53744.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.51.6e-50111461128
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkk......lelee......vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                   lppGfrFhP+d+elv +yL +k++g        +   +      ++ +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat+sgyWka
  MLOC_53744.1  11 LPPGFRFHPRDDELVLDYLSRKLSGGAggaaaaV---SsiygcpAMVDVDLNKIEPWDLPEIACIGGKEWYFYSLRDRKYATGQRTNRATESGYWKA 104
                   79***********************997765441...145666579**************7666789****************************** PP

           NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                   tgkd+++ + kg lvg++ktLvfy+grapkg+kt+Wvmhe+r 
  MLOC_53744.1 105 TGKDRSISR-KGLLVGMRKTLVFYQGRAPKGKKTEWVMHEFRR 146
                   *******99.999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-583169IPR003441NAC domain
PROSITE profilePS5100554.36311169IPR003441NAC domain
PfamPF023651.8E-2512145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MNSLSMVEAR LPPGFRFHPR DDELVLDYLS RKLSGGAGGA AAAVSSIYGC PAMVDVDLNK  60
IEPWDLPEIA CIGGKEWYFY SLRDRKYATG QRTNRATESG YWKATGKDRS ISRKGLLVGM  120
RKTLVFYQGR APKGKKTEWV MHEFRREGQG DLMKLPLKED WVLCRVFYKT RATIAKPPTG  180
SSYNIDSAAA TSLPPLIDNY IAFDHPGMSA VQNLEGYEQV PCFSNNPSSH PSSSASMNIP  240
VTAMPPMAAD QEQQHMGKAI KDVLSQLSRF EQGNVKREAP TQGGVFAQDG FEYLAESGFS  300
QMWNSLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-48716911168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3562230.0AK356223.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1031L15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563412.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE61e-89NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0WQ930.0M0WQ93_HORVD; Uncharacterized protein
STRINGMLOC_53744.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-88NAC domain containing protein 1